PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G24310.1
Common NameATMYB71, MYB305
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 269aa    MW: 30786.6 Da    PI: 8.869
Description myb domain protein 305
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G24310.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.21e-192067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll+d+v+++G g+W+++ar  g++R +k+c++rw +yl
      AT3G24310.1 20 KGPWTAEEDRLLIDYVQLHGEGRWNSVARLAGLKRNGKSCRLRWVNYL 67
                     79********************************************97 PP

2Myb_DNA-binding52.61.1e-1673117147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
      AT3G24310.1  73 RGQITPHEETIILELHAKWGNR-WSTIARSLP-GRTDNEIKNYWRTH 117
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.4031571IPR017930Myb domain
SuperFamilySSF466894.87E-3117114IPR009057Homeodomain-like
SMARTSM007177.7E-171969IPR001005SANT/Myb domain
PfamPF002497.0E-182067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-242174IPR009057Homeodomain-like
CDDcd001672.21E-122267No hitNo description
PROSITE profilePS5129419.68272122IPR017930Myb domain
SMARTSM007174.7E-1572120IPR001005SANT/Myb domain
PfamPF002495.0E-1473117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2475121IPR009057Homeodomain-like
CDDcd001671.11E-1077118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MSLWGGMGGG WGMVEEGWRK GPWTAEEDRL LIDYVQLHGE GRWNSVARLA GLKRNGKSCR  60
LRWVNYLRPD LKRGQITPHE ETIILELHAK WGNRWSTIAR SLPGRTDNEI KNYWRTHFKK  120
KTKSPTNSAE KTKNRILKRQ QFQQQRQMEL QQEQQLLQFN QIDMKKIMSL LDDDNNNGDN  180
TFSSSSSGES GALYVPHQIT HSTTTSGCEP NSNGYYPVVP VTIPEANVNE DNAIWDGLWN  240
LDFEGQGSFG GAACAPRKHY FQNMVIPFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-272012227128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO17325120.0
Genevisible257163_at0.0
Expression AtlasAT3G24310-
AtGenExpressAT3G24310-
ATTED-IIAT3G24310-
Functional Description ? help Back to Top
Source Description
TAIRsnapdragon myb protein 305 homolog (myb)
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G24310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G24310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5502980.0AY550298.1 Arabidopsis thaliana MYB transcription factor (At3g24310) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189074.10.0myb domain protein 305
TrEMBLQ9LK140.0Q9LK14_ARATH; MYB-like DNA-binding domain protein
STRINGAT3G24310.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31072766
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Xia G, et al.
    Identification of plant cytoskeletal, cell cycle-related and polarity-related proteins using Schizosaccharomyces pombe.
    Plant J., 1996. 10(4): p. 761-9
    [PMID:8893552]
  4. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]